DrugLib.com — Drug Information Portal

Rx drug information, pharmaceutical research, clinical trials, news, and more

Active ingredient: Interferon Beta-1a - Chemisty and Biological Activity

Chemisty and Biological Activity

Chemical Formula

C908H1408N246O252S7

Chemical Name

Human interferon beta

Chemical Structure

MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQF QKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKT VLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEI LRNFYFINRLTGYLRN

Molecular Weight

20027.0

Physical State

Liquid

Melting Point

Not Available

Water Solubility

Not Available

Isoelectric Point

8.93

Organisms Affected

Not Available

Phase 1 Metabolising Enzyme (1-st Step of Metabolism)

Not Available

Primary Drug Target
NameInterferon receptor IFNAR1
Gene NameIFNAR1
SynonymsInterferon-alpha/beta receptor alpha chain precursor; IFN-alpha-REC
Specific FunctionReceptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta- subunits themselves

-- advertisement -- The American Red Cross
 
Home | About Us | Contact Us | Site usage policy | Privacy policy

All Rights reserved - Copyright DrugLib.com, 2006-2017